Lineage for d2opsa3 (2ops A:430-543)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860258Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 1860267Domain d2opsa3: 2ops A:430-543 [198213]
    Other proteins in same PDB: d2opsa2, d2opsb_
    complexed with hbq, po4; mutant

Details for d2opsa3

PDB Entry: 2ops (more details), 2.3 Å

PDB Description: crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2opsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opsa3 c.55.3.0 (A:430-543) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

SCOPe Domain Coordinates for d2opsa3:

Click to download the PDB-style file with coordinates for d2opsa3.
(The format of our PDB-style files is described here.)

Timeline for d2opsa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2opsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2opsb_