Lineage for d1igjd1 (1igj D:2-114)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546882Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 546978Domain d1igjd1: 1igj D:2-114 [19821]
    Other proteins in same PDB: d1igja1, d1igja2, d1igjb2, d1igjc1, d1igjc2, d1igjd2
    part of Fab 26-10
    complexed with dgx

Details for d1igjd1

PDB Entry: 1igj (more details), 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igjd1 b.1.1.1 (D:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa

SCOP Domain Coordinates for d1igjd1:

Click to download the PDB-style file with coordinates for d1igjd1.
(The format of our PDB-style files is described here.)

Timeline for d1igjd1: