SCOPe 2.03: Domain d1igjc1: 1igj C:1-107

Lineage for d1igjc1 (1igj C:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
   Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

8. Domain d1igjc1: 1igj C:1-107 [19820]
   Other proteins in same PDB: d1igja2, d1igjb1, d1igjb2, d1igjc2, d1igjd1, d1igjd2
   part of Fab 26-10
   complexed with dgx

Details for d1igjc1

PDB Entry: 1igj, 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

PDB Compounds: (C:) igg2a-kappa 26-10 fab (light chain)

SCOPe Domain Sequences for d1igjc1:

Sequence; same for both SEQRES and ATOM records:

>d1igjc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleik

Timeline for d1igjc1:

• d1igjc1 first appeared (with stable ids) in SCOP 1.55
  
• d1igjc1 appears in SCOPe 2.02
  
• d1igjc1 appears in SCOPe 2.04
  
• d1igjc1 appears in the current release, SCOPe 2.08