SCOP 1.59: Domain d1igjc1: 1igj C:1-107

Lineage for d1igjc1 (1igj C:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)

8. Domain d1igjc1: 1igj C:1-107 [19820]
   Other proteins in same PDB: d1igja2, d1igjb2, d1igjc2, d1igjd2

Details for d1igjc1

PDB Entry: 1igj, 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjc1:

Sequence; same for both SEQRES and ATOM records:

>d1igjc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleik

Timeline for d1igjc1:

• d1igjc1 first appeared (with stable ids) in SCOP 1.55
  
• d1igjc1 appears in SCOP 1.57
  
• d1igjc1 appears in SCOP 1.61
  
• d1igjc1 appears in the current release, SCOPe 2.08