Lineage for d2ntsa1 (2nts A:1-86)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1541040Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1541041Protein automated matches [226834] (4 species)
    not a true protein
  7. 1541066Species Staphylococcus aureus [TaxId:93062] [225286] (3 PDB entries)
  8. 1541070Domain d2ntsa1: 2nts A:1-86 [198183]
    Other proteins in same PDB: d2ntsa2, d2ntsp1, d2ntsp2
    automated match to d2g9hd1

Details for d2ntsa1

PDB Entry: 2nts (more details), 2.4 Å

PDB Description: Crystal Structure of SEK-hVb5.1
PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d2ntsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntsa1 b.40.2.0 (A:1-86) automated matches {Staphylococcus aureus [TaxId: 93062]}
qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
kldvfgisyngqsntkyiyggvtatn

SCOPe Domain Coordinates for d2ntsa1:

Click to download the PDB-style file with coordinates for d2ntsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ntsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ntsa2