![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
![]() | Protein automated matches [226834] (4 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225286] (3 PDB entries) |
![]() | Domain d2ntsa1: 2nts A:1-86 [198183] Other proteins in same PDB: d2ntsa2, d2ntsp1, d2ntsp2 automated match to d2g9hd1 |
PDB Entry: 2nts (more details), 2.4 Å
SCOPe Domain Sequences for d2ntsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntsa1 b.40.2.0 (A:1-86) automated matches {Staphylococcus aureus [TaxId: 93062]} qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk kldvfgisyngqsntkyiyggvtatn
Timeline for d2ntsa1: