Lineage for d2nr6e2 (2nr6 E:108-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031101Domain d2nr6e2: 2nr6 E:108-211 [198182]
    Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c1, d2nr6d1, d2nr6e1, d2nr6f1
    automated match to d1c12a2
    complexed with nag, zn

Details for d2nr6e2

PDB Entry: 2nr6 (more details), 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2
PDB Compounds: (E:) Antibody Light Chain

SCOPe Domain Sequences for d2nr6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr6e2 b.1.1.2 (E:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2nr6e2:

Click to download the PDB-style file with coordinates for d2nr6e2.
(The format of our PDB-style files is described here.)

Timeline for d2nr6e2: