Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d2nr6c1: 2nr6 C:1-107 [198179] Other proteins in same PDB: d2nr6a_, d2nr6b_, d2nr6c2, d2nr6d1, d2nr6e2, d2nr6f1 automated match to d1c12a1 complexed with nag, zn |
PDB Entry: 2nr6 (more details), 2.81 Å
SCOPe Domain Sequences for d2nr6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr6c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleik
Timeline for d2nr6c1: