Lineage for d2nr6b1 (2nr6 B:-4-327)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2070410Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2070411Protein automated matches [190954] (11 species)
    not a true protein
  7. 2070412Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)
  8. 2070416Domain d2nr6b1: 2nr6 B:-4-327 [198178]
    Other proteins in same PDB: d2nr6a2, d2nr6b2, d2nr6c1, d2nr6c2, d2nr6d1, d2nr6e1, d2nr6e2, d2nr6f1
    automated match to d1yg9a_
    complexed with nag, zn

Details for d2nr6b1

PDB Entry: 2nr6 (more details), 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2
PDB Compounds: (B:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d2nr6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr6b1 b.50.1.0 (B:-4-327) automated matches {Blattella germanica [TaxId: 6973]}
vplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqkyekl
kpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsadvvv
giaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyvdgef
tyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaigcvve
ktttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsdhffi
gdffvdhyysefnwenktmgfgrsve

SCOPe Domain Coordinates for d2nr6b1:

Click to download the PDB-style file with coordinates for d2nr6b1.
(The format of our PDB-style files is described here.)

Timeline for d2nr6b1: