Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (9 species) not a true protein |
Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries) |
Domain d2nr6b_: 2nr6 B: [198178] Other proteins in same PDB: d2nr6c1, d2nr6c2, d2nr6d1, d2nr6e1, d2nr6e2, d2nr6f1 automated match to d1yg9a_ complexed with nag, zn |
PDB Entry: 2nr6 (more details), 2.81 Å
SCOPe Domain Sequences for d2nr6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr6b_ b.50.1.0 (B:) automated matches {Blattella germanica [TaxId: 6973]} gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd hffigdffvdhyysefnwenktmgfgrsve
Timeline for d2nr6b_: