Lineage for d2jj2f3 (2jj2 F:358-474)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273476Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1273477Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1273478Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1273534Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1273537Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 1273558Domain d2jj2f3: 2jj2 F:358-474 [198165]
    Other proteins in same PDB: d2jj2d1, d2jj2d2, d2jj2e1, d2jj2e2, d2jj2f1, d2jj2f2, d2jj2g_, d2jj2k1, d2jj2k2, d2jj2l1, d2jj2l2, d2jj2m1, d2jj2m2, d2jj2n_
    automated match to d1w0jd1
    complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2f3

PDB Entry: 2jj2 (more details), 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.
PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj2f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj2f3 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d2jj2f3:

Click to download the PDB-style file with coordinates for d2jj2f3.
(The format of our PDB-style files is described here.)

Timeline for d2jj2f3: