Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries) Uniprot P00829 |
Domain d2jj2e1: 2jj2 E:9-81 [198160] Other proteins in same PDB: d2jj2d2, d2jj2d3, d2jj2e2, d2jj2e3, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2k2, d2jj2k3, d2jj2l2, d2jj2l3, d2jj2m2, d2jj2m3, d2jj2n_ automated match to d1w0jd2 complexed with adp, anp, azi, gol, mg, po4, que |
PDB Entry: 2jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d2jj2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj2e1 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d2jj2e1: