SCOP 1.59: Domain d2igfl1: 2igf L:1-107

Lineage for d2igfl1 (2igf L:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab B13I2 (mouse), kappa L chain [48760] (2 PDB entries)

8. Domain d2igfl1: 2igf L:1-107 [19816]
   Other proteins in same PDB: d2igfh2, d2igfl2

Details for d2igfl1

PDB Entry: 2igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d2igfl1:

Sequence; same for both SEQRES and ATOM records:

>d2igfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d2igfl1:

• d2igfl1 first appeared (with stable ids) in SCOP 1.55
  
• d2igfl1 appears in SCOP 1.57
  
• d2igfl1 appears in SCOP 1.61
  
• d2igfl1 appears in the current release, SCOPe 2.08