Lineage for d2jj1m3 (2jj1 M:358-474)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739161Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1739216Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1739219Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 1739249Domain d2jj1m3: 2jj1 M:358-474 [198156]
    Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1e1, d2jj1e2, d2jj1f1, d2jj1f2, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1l1, d2jj1l2, d2jj1m1, d2jj1m2, d2jj1n_
    automated match to d1w0jd1
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1m3

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj1m3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj1m3 a.69.1.1 (M:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d2jj1m3:

Click to download the PDB-style file with coordinates for d2jj1m3.
(The format of our PDB-style files is described here.)

Timeline for d2jj1m3: