Lineage for d2jj1l3 (2jj1 L:358-474)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273476Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1273477Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1273478Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1273534Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1273537Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 1273569Domain d2jj1l3: 2jj1 L:358-474 [198153]
    Other proteins in same PDB: d2jj1d1, d2jj1d2, d2jj1e1, d2jj1e2, d2jj1f1, d2jj1f2, d2jj1g_, d2jj1k1, d2jj1k2, d2jj1l1, d2jj1l2, d2jj1m1, d2jj1m2, d2jj1n_
    automated match to d1w0jd1
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1l3

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (L:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj1l3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj1l3 a.69.1.1 (L:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d2jj1l3:

Click to download the PDB-style file with coordinates for d2jj1l3.
(The format of our PDB-style files is described here.)

Timeline for d2jj1l3: