Lineage for d1igfj1 (1igf J:1-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756016Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1756057Domain d1igfj1: 1igf J:1-113 [19815]
    Other proteins in same PDB: d1igfh2, d1igfj2, d1igfl1, d1igfl2, d1igfm1, d1igfm2
    part of Fab B13I2
    complexed with nag

Details for d1igfj1

PDB Entry: 1igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
PDB Compounds: (J:) igg1-kappa b13i2 fab (heavy chain)

SCOPe Domain Sequences for d1igfj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igfj1 b.1.1.1 (J:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvss

SCOPe Domain Coordinates for d1igfj1:

Click to download the PDB-style file with coordinates for d1igfj1.
(The format of our PDB-style files is described here.)

Timeline for d1igfj1: