Lineage for d2jj1e1 (2jj1 E:9-81)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795828Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1795831Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 1795857Domain d2jj1e1: 2jj1 E:9-81 [198142]
    Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d2, d2jj1d3, d2jj1e2, d2jj1e3, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k2, d2jj1k3, d2jj1l2, d2jj1l3, d2jj1m2, d2jj1m3, d2jj1n_
    automated match to d1w0jd2
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1e1

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj1e1 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d2jj1e1:

Click to download the PDB-style file with coordinates for d2jj1e1.
(The format of our PDB-style files is described here.)

Timeline for d2jj1e1: