Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries) Uniprot P00829 |
Domain d2jizm3: 2jiz M:358-474 [198136] Other proteins in same PDB: d2jizd1, d2jizd2, d2jize1, d2jize2, d2jizf1, d2jizf2, d2jizg_, d2jizk1, d2jizk2, d2jizl1, d2jizl2, d2jizm1, d2jizm2, d2jizn_ automated match to d1w0jd1 complexed with adp, anp, azi, gol, mg, po4, stl |
PDB Entry: 2jiz (more details), 2.3 Å
SCOPe Domain Sequences for d2jizm3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jizm3 a.69.1.1 (M:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d2jizm3: