SCOPe 2.06: Domain d2jize1: 2jiz E:9-81

Lineage for d2jize1 (2jiz E:9-81)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
   Uniprot P00829

8. Domain d2jize1: 2jiz E:9-81 [198122]
   Other proteins in same PDB: d2jiza1, d2jiza2, d2jiza3, d2jizb1, d2jizb2, d2jizb3, d2jizc1, d2jizc2, d2jizc3, d2jizd2, d2jizd3, d2jize2, d2jize3, d2jizf2, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizh3, d2jizi1, d2jizi2, d2jizi3, d2jizj1, d2jizj2, d2jizj3, d2jizk2, d2jizk3, d2jizl2, d2jizl3, d2jizm2, d2jizm3, d2jizn_
   automated match to d1w0jd2
   complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jize1

PDB Entry: 2jiz, 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jize1:

Sequence; same for both SEQRES and ATOM records:

>d2jize1 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d2jize1:

• d2jize1 first appeared in SCOPe 2.03
  
• d2jize1 appears in SCOPe 2.05
  
• d2jize1 appears in SCOPe 2.07
  
• d2jize1 appears in the current release, SCOPe 2.08