Lineage for d1igfl1 (1igf L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653294Domain d1igfl1: 1igf L:1-107 [19812]
    Other proteins in same PDB: d1igfh1, d1igfh2, d1igfj1, d1igfj2, d1igfl2, d1igfm2

Details for d1igfl1

PDB Entry: 1igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
PDB Compounds: (L:) igg1-kappa b13i2 fab (light chain)

SCOP Domain Sequences for d1igfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igfl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

SCOP Domain Coordinates for d1igfl1:

Click to download the PDB-style file with coordinates for d1igfl1.
(The format of our PDB-style files is described here.)

Timeline for d1igfl1: