SCOPe 2.01: Domain d1dfbh1: 1dfb H:1-126

Lineage for d1dfbh1 (1dfb H:1-126)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d1dfbh1: 1dfb H:1-126 [19811]
   Other proteins in same PDB: d1dfbh2, d1dfbl1, d1dfbl2
   part of Fab 3D6

Details for d1dfbh1

PDB Entry: 1dfb, 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

PDB Compounds: (H:) igg1-kappa 3d6 fab (heavy chain)

SCOPe Domain Sequences for d1dfbh1:

Sequence; same for both SEQRES and ATOM records:

>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfndyamhwvrqapgkglewvsgiswdsssigy
adsvkgrftisrdnaknslylqmnslraedmalyycvkgrdyydsggyftvafdiwgqgt
mvtvss

Timeline for d1dfbh1:

• d1dfbh1 first appeared (with stable ids) in SCOP 1.55
  
• d1dfbh1 appears in SCOP 1.75
  
• d1dfbh1 appears in SCOPe 2.02
  
• d1dfbh1 appears in the current release, SCOPe 2.08