Lineage for d2jb6a2 (2jb6 A:113-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763428Domain d2jb6a2: 2jb6 A:113-214 [198103]
    Other proteins in same PDB: d2jb6a1, d2jb6b1, d2jb6b2, d2jb6h1, d2jb6h2, d2jb6l1
    automated match to d1jvka2
    complexed with t5c

Details for d2jb6a2

PDB Entry: 2jb6 (more details), 2.85 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-2
PDB Compounds: (A:) fab fragment mor03268 light chain

SCOPe Domain Sequences for d2jb6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb6a2 b.1.1.2 (A:113-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d2jb6a2:

Click to download the PDB-style file with coordinates for d2jb6a2.
(The format of our PDB-style files is described here.)

Timeline for d2jb6a2: