SCOPe 2.05: Domain d2jb5l2: 2jb5 L:113-214

Lineage for d2jb5l2 (2jb5 L:113-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d2jb5l2: 2jb5 L:113-214 [198101]
   Other proteins in same PDB: d2jb5h1, d2jb5h2, d2jb5l1
   automated match to d1jvka2
   complexed with t5c

Details for d2jb5l2

PDB Entry: 2jb5, 2.8 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-1

PDB Compounds: (L:) fab fragment mor03268 light chain

SCOPe Domain Sequences for d2jb5l2:

Sequence; same for both SEQRES and ATOM records:

>d2jb5l2 b.1.1.2 (L:113-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d2jb5l2:

• d2jb5l2 first appeared in SCOPe 2.03
  
• d2jb5l2 appears in SCOPe 2.04
  
• d2jb5l2 appears in SCOPe 2.06
  
• d2jb5l2 appears in the current release, SCOPe 2.08