SCOP 1.67: Domain d1dfbl1: 1dfb L:1-106

Lineage for d1dfbl1 (1dfb L:1-106)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1dfbl1: 1dfb L:1-106 [19810]
   Other proteins in same PDB: d1dfbh1, d1dfbh2, d1dfbl2
   part of Fab 3D6

Details for d1dfbl1

PDB Entry: 1dfb, 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbl1:

Sequence; same for both SEQRES and ATOM records:

>d1dfbl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikr

Timeline for d1dfbl1:

• d1dfbl1 first appeared (with stable ids) in SCOP 1.55
  
• d1dfbl1 appears in SCOP 1.65
  
• d1dfbl1 appears in SCOP 1.69
  
• d1dfbl1 appears in the current release, SCOPe 2.08