SCOP 1.61: Domain d1dfbl1: 1dfb L:1-106

Lineage for d1dfbl1 (1dfb L:1-106)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 3D6 (human), kappa L chain [48759] (1 PDB entry)

8. Domain d1dfbl1: 1dfb L:1-106 [19810]
   Other proteins in same PDB: d1dfbh2, d1dfbl2

Details for d1dfbl1

PDB Entry: 1dfb, 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbl1:

Sequence; same for both SEQRES and ATOM records:

>d1dfbl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab 3D6 (human), kappa L chain}
diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikr

Timeline for d1dfbl1:

• d1dfbl1 first appeared (with stable ids) in SCOP 1.55
  
• d1dfbl1 appears in SCOP 1.59
  
• d1dfbl1 appears in SCOP 1.63
  
• d1dfbl1 appears in the current release, SCOPe 2.08