Lineage for d1dfbl1 (1dfb L:1-106)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7409Species Fab 3D6 (human), kappa L chain [48759] (1 PDB entry)
  8. 7411Domain d1dfbl1: 1dfb L:1-106 [19810]
    Other proteins in same PDB: d1dfbh2, d1dfbl2

Details for d1dfbl1

PDB Entry: 1dfb (more details), 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfbl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab 3D6 (human), kappa L chain}
diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikr

SCOP Domain Coordinates for d1dfbl1:

Click to download the PDB-style file with coordinates for d1dfbl1.
(The format of our PDB-style files is described here.)

Timeline for d1dfbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfbl2