Lineage for d2j9fd2 (2j9f D:205-342)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488687Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2488688Protein automated matches [226991] (9 species)
    not a true protein
  7. 2488730Species Human (Homo sapiens) [TaxId:9606] [226799] (1 PDB entry)
  8. 2488732Domain d2j9fd2: 2j9f D:205-342 [198099]
    Other proteins in same PDB: d2j9fa_, d2j9fb1, d2j9fb3, d2j9fc_, d2j9fd1, d2j9fd3
    automated match to d1ik6a2
    complexed with gol, k, mn, thv

Details for d2j9fd2

PDB Entry: 2j9f (more details), 1.88 Å

PDB Description: human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b
PDB Compounds: (D:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2j9fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9fd2 c.48.1.0 (D:205-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOPe Domain Coordinates for d2j9fd2:

Click to download the PDB-style file with coordinates for d2j9fd2.
(The format of our PDB-style files is described here.)

Timeline for d2j9fd2: