Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226799] (1 PDB entry) |
Domain d2j9fd2: 2j9f D:205-342 [198099] Other proteins in same PDB: d2j9fa_, d2j9fb1, d2j9fb3, d2j9fc_, d2j9fd1, d2j9fd3 automated match to d1ik6a2 complexed with gol, k, mn, thv |
PDB Entry: 2j9f (more details), 1.88 Å
SCOPe Domain Sequences for d2j9fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9fd2 c.48.1.0 (D:205-342) automated matches {Human (Homo sapiens) [TaxId: 9606]} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d2j9fd2: