Lineage for d2dblh1 (2dbl H:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652764Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
  8. 652801Domain d2dblh1: 2dbl H:1-112 [19809]
    Other proteins in same PDB: d2dblh2, d2dbll1, d2dbll2
    part of Fab DB3
    complexed with s5h

Details for d2dblh1

PDB Entry: 2dbl (more details), 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
PDB Compounds: (H:) igg1-kappa db3 fab (heavy chain)

SCOP Domain Sequences for d2dblh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dblh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

SCOP Domain Coordinates for d2dblh1:

Click to download the PDB-style file with coordinates for d2dblh1.
(The format of our PDB-style files is described here.)

Timeline for d2dblh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dblh2