SCOP 1.55: Domain d2dbll1: 2dbl L:1-107

Lineage for d2dbll1 (2dbl L:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)

8. Domain d2dbll1: 2dbl L:1-107 [19808]
   Other proteins in same PDB: d2dblh2, d2dbll2

Details for d2dbll1

PDB Entry: 2dbl, 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dbll1:

Sequence; same for both SEQRES and ATOM records:

>d2dbll1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

SCOP Domain Coordinates for d2dbll1 are not available.

Timeline for d2dbll1:

• d2dbll1 appears in SCOP 1.57
  
• d2dbll1 appears in the current release, SCOPe 2.08