SCOP 1.55: Domain d1dbkh1: 1dbk H:1-112

Lineage for d1dbkh1 (1dbk H:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)

8. Domain d1dbkh1: 1dbk H:1-112 [19807]
   Other proteins in same PDB: d1dbkh2, d1dbkl2

Details for d1dbkh1

PDB Entry: 1dbk, 3 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbkh1:

Sequence; same for both SEQRES and ATOM records:

>d1dbkh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

Timeline for d1dbkh1:

• d1dbkh1 appears in SCOP 1.57
  
• d1dbkh1 appears in the current release, SCOPe 2.08