SCOPe 2.08: Domain d1dbkh1: 1dbk H:1-112

Lineage for d1dbkh1 (1dbk H:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1dbkh1: 1dbk H:1-112 [19807]
   Other proteins in same PDB: d1dbkh2, d1dbkl1, d1dbkl2
   part of Fab DB3
   complexed with ano

Details for d1dbkh1

PDB Entry: 1dbk, 3 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

PDB Compounds: (H:) igg1-kappa db3 fab (heavy chain)

SCOPe Domain Sequences for d1dbkh1:

Sequence; same for both SEQRES and ATOM records:

>d1dbkh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

Timeline for d1dbkh1:

• d1dbkh1 first appeared (with stable ids) in SCOP 1.55
  
• d1dbkh1 appears in SCOPe 2.07