Lineage for d1dbkl1 (1dbk L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353891Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 2354040Domain d1dbkl1: 1dbk L:1-107 [19806]
    Other proteins in same PDB: d1dbkh1, d1dbkh2, d1dbkl2
    part of Fab DB3
    complexed with ano

Details for d1dbkl1

PDB Entry: 1dbk (more details), 3 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
PDB Compounds: (L:) igg1-kappa db3 fab (light chain)

SCOPe Domain Sequences for d1dbkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbkl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

SCOPe Domain Coordinates for d1dbkl1:

Click to download the PDB-style file with coordinates for d1dbkl1.
(The format of our PDB-style files is described here.)

Timeline for d1dbkl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbkl2