Lineage for d2iant2 (2ian T:113-240)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517802Domain d2iant2: 2ian T:113-240 [198059]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iane1, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2ianj1, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iano1, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2iant1
    automated match to d1qsee2
    mutant

Details for d2iant2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (T:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iant2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iant2 b.1.1.2 (T:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d2iant2:

Click to download the PDB-style file with coordinates for d2iant2.
(The format of our PDB-style files is described here.)

Timeline for d2iant2: