SCOPe 2.03: Domain d2iant2: 2ian T:113-240

Lineage for d2iant2 (2ian T:113-240)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d2iant2: 2ian T:113-240 [198059]
   Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iane1, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2ianj1, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iano1, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2iant1
   automated match to d1qsee2
   mutant

Details for d2iant2

PDB Entry: 2ian, 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (T:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iant2:

Sequence; same for both SEQRES and ATOM records:

>d2iant2 b.1.1.2 (T:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d2iant2:

• d2iant2 is new in SCOPe 2.03-stable
  
• d2iant2 appears in SCOPe 2.04
  
• d2iant2 appears in the current release, SCOPe 2.08