SCOPe 2.08: Domain d2iant1: 2ian T:3-112

Lineage for d2iant1 (2ian T:3-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2iant1: 2ian T:3-112 [198058]
   Other proteins in same PDB: d2iana1, d2iana2, d2iana3, d2ianb1, d2ianb2, d2iand2, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani2, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann2, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians2, d2iant2
   automated match to d1qrne1
   mutant

Details for d2iant1

PDB Entry: 2ian, 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (T:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iant1:

Sequence; same for both SEQRES and ATOM records:

>d2iant1 b.1.1.0 (T:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevpn
gynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvved

Timeline for d2iant1:

• d2iant1 first appeared in SCOPe 2.03
  
• d2iant1 appears in SCOPe 2.07