Lineage for d2ians1 (2ian S:1-109)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520095Domain d2ians1: 2ian S:1-109 [198056]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand2, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani2, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann2, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians2, d2iant2
    automated match to d1qrnd1
    mutant

Details for d2ians1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (S:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2ians1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ians1 b.1.1.0 (S:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d2ians1:

Click to download the PDB-style file with coordinates for d2ians1.
(The format of our PDB-style files is described here.)

Timeline for d2ians1: