Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d2iano1: 2ian O:3-112 [198054] Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand2, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani2, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann2, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians2, d2iant2 automated match to d1qrne1 mutant |
PDB Entry: 2ian (more details), 2.8 Å
SCOPe Domain Sequences for d2iano1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iano1 b.1.1.0 (O:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevpn gynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvved
Timeline for d2iano1:
View in 3D Domains from other chains: (mouse over for more information) d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iann2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2 |