Lineage for d1dbmh1 (1dbm H:1-112)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102673Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)
  8. 102680Domain d1dbmh1: 1dbm H:1-112 [19805]
    Other proteins in same PDB: d1dbmh2, d1dbml2

Details for d1dbmh1

PDB Entry: 1dbm (more details), 2.7 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbmh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

SCOP Domain Coordinates for d1dbmh1:

Click to download the PDB-style file with coordinates for d1dbmh1.
(The format of our PDB-style files is described here.)

Timeline for d1dbmh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbmh2