Lineage for d2iani2 (2ian I:110-198)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362447Domain d2iani2: 2ian I:110-198 [198049]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iane1, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2ianj1, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iano1, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2iant1
    automated match to d1qrnd2
    mutant

Details for d2iani2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (I:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iani2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iani2 b.1.1.2 (I:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2iani2:

Click to download the PDB-style file with coordinates for d2iani2.
(The format of our PDB-style files is described here.)

Timeline for d2iani2: