Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d2iand2: 2ian D:110-198 [198045] Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iane1, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2ianj1, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iano1, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2iant1 automated match to d1qrnd2 mutant |
PDB Entry: 2ian (more details), 2.8 Å
SCOPe Domain Sequences for d2iand2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iand2 b.1.1.2 (D:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d2iand2:
View in 3D Domains from other chains: (mouse over for more information) d2iana1, d2iana2, d2ianb1, d2ianb2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2 |