SCOP 1.71: Domain d1dbml1: 1dbm L:1-107

Lineage for d1dbml1 (1dbm L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1dbml1: 1dbm L:1-107 [19804]
   Other proteins in same PDB: d1dbmh1, d1dbmh2, d1dbml2
   part of Fab DB3
   complexed with sih

Details for d1dbml1

PDB Entry: 1dbm, 2.7 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbml1:

Sequence; same for both SEQRES and ATOM records:

>d1dbml1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

Timeline for d1dbml1:

• d1dbml1 first appeared (with stable ids) in SCOP 1.55
  
• d1dbml1 appears in SCOP 1.69
  
• d1dbml1 appears in SCOP 1.73
  
• d1dbml1 appears in the current release, SCOPe 2.08