Lineage for d1dbml1 (1dbm L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219719Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)
  8. 219727Domain d1dbml1: 1dbm L:1-107 [19804]
    Other proteins in same PDB: d1dbmh2, d1dbml2

Details for d1dbml1

PDB Entry: 1dbm (more details), 2.7 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbml1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

SCOP Domain Coordinates for d1dbml1:

Click to download the PDB-style file with coordinates for d1dbml1.
(The format of our PDB-style files is described here.)

Timeline for d1dbml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbml2