SCOPe 2.08: Domain d2iaja2: 2iaj A:430-551

Lineage for d2iaja2 (2iaj A:430-551)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)

8. Domain d2iaja2: 2iaj A:430-551 [198039]
   Other proteins in same PDB: d2iaja1, d2iajb_
   automated match to d1bqna1
   protein/DNA complex; complexed with atp, gol, mn, na; mutant

Details for d2iaja2

PDB Entry: 2iaj, 2.5 Å

PDB Description: crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H (p66 RT)

SCOPe Domain Sequences for d2iaja2:

Sequence; same for both SEQRES and ATOM records:

>d2iaja2 c.55.3.0 (A:430-551) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
kl

Timeline for d2iaja2:

• d2iaja2 first appeared in SCOPe 2.03
  
• d2iaja2 appears in SCOPe 2.07