Lineage for d2hv8f_ (2hv8 F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709345Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 1709346Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 1709352Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)
  7. 1709353Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
    Uniprot O75154 703-756! Uniprot O75154 715-756
  8. 1709358Domain d2hv8f_: 2hv8 F: [198027]
    Other proteins in same PDB: d2hv8a_, d2hv8b_, d2hv8c_
    automated match to d2hv8d1
    complexed with 2me, gtp, mes, mg, so4

Details for d2hv8f_

PDB Entry: 2hv8 (more details), 1.86 Å

PDB Description: Crystal structure of GTP-bound Rab11 in complex with FIP3
PDB Compounds: (F:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2hv8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv8f_ h.1.31.1 (F:) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
srdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOPe Domain Coordinates for d2hv8f_:

Click to download the PDB-style file with coordinates for d2hv8f_.
(The format of our PDB-style files is described here.)

Timeline for d2hv8f_: