SCOPe 2.05: Domain d2hfgl2: 2hfg L:107-212

Lineage for d2hfgl2 (2hfg L:107-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d2hfgl2: 2hfg L:107-212 [198007]
   Other proteins in same PDB: d2hfgh1, d2hfgh2, d2hfgl1, d2hfgr_
   automated match to d1rhha2

Details for d2hfgl2

PDB Entry: 2hfg, 2.61 Å

PDB Description: crystal structure of hbr3 bound to cb3s-fab

PDB Compounds: (L:) CB3s Fab light chain (kappa)

SCOPe Domain Sequences for d2hfgl2:

Sequence; same for both SEQRES and ATOM records:

>d2hfgl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d2hfgl2:

• d2hfgl2 first appeared in SCOPe 2.03
  
• d2hfgl2 appears in SCOPe 2.04
  
• d2hfgl2 appears in SCOPe 2.06
  
• d2hfgl2 appears in the current release, SCOPe 2.08