SCOPe 2.05: Domain d2hffl2: 2hff L:107-210

Lineage for d2hffl2 (2hff L:107-210)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d2hffl2: 2hff L:107-210 [198005]
Other proteins in same PDB: d2hffa1, d2hffb1, d2hffb2, d2hffh1, d2hffh2, d2hffl1
automated match to d1rhha2

Details for d2hffl2

PDB Entry: 2hff (more details), 1.95 Å

PDB Description: Crystal structure of CB2 Fab

PDB Compounds: (L:) CB2 Fab, light chain

SCOPe Domain Sequences for d2hffl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hffl2 b.1.1.2 (L:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2hffl2:

Click to download the PDB-style file with coordinates for d2hffl2.
(The format of our PDB-style files is described here.)

Timeline for d2hffl2: