SCOPe 2.07: Domain d2hffa1: 2hff A:2-106A

Lineage for d2hffa1 (2hff A:2-106A)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2hffa1: 2hff A:2-106A [198002]
   Other proteins in same PDB: d2hffa2, d2hffb1, d2hffb2, d2hffh1, d2hffh2, d2hffl2
   automated match to d1rhha1

Details for d2hffa1

PDB Entry: 2hff, 1.95 Å

PDB Description: Crystal structure of CB2 Fab

PDB Compounds: (A:) CB2 Fab, light chain

SCOPe Domain Sequences for d2hffa1:

Sequence; same for both SEQRES and ATOM records:

>d2hffa1 b.1.1.0 (A:2-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvpsr
fsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveik

Timeline for d2hffa1:

• d2hffa1 first appeared in SCOPe 2.03
  
• d2hffa1 appears in SCOPe 2.06
  
• d2hffa1 appears in the current release, SCOPe 2.08