![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d2hffa1: 2hff A:2-106A [198002] Other proteins in same PDB: d2hffa2, d2hffb1, d2hffb2, d2hffh1, d2hffh2, d2hffl2 automated match to d1rhha1 |
PDB Entry: 2hff (more details), 1.95 Å
SCOPe Domain Sequences for d2hffa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hffa1 b.1.1.0 (A:2-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvpsr fsgsgsgtdftltisslqpedfatyycqqsritpptfgqgtkveik
Timeline for d2hffa1: