Class g: Small proteins [56992] (98 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.1: TNF receptor-like [57587] (6 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
Protein Death receptor-5 (dr5) fragment [57590] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries) |
Domain d2h9gs1: 2h9g S:21-61 [198000] Other proteins in same PDB: d2h9ga1, d2h9ga2, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl1, d2h9gl2 automated match to d1d0gr1 |
PDB Entry: 2h9g (more details), 2.32 Å
SCOPe Domain Sequences for d2h9gs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9gs1 g.24.1.1 (S:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]} sspseglcppghhisedgrdcisckygqdysthwndllfcl
Timeline for d2h9gs1: