Lineage for d2h9gs1 (2h9g S:21-61)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704289Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1704290Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 1704291Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1704300Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 1704301Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 1704308Domain d2h9gs1: 2h9g S:21-61 [198000]
    Other proteins in same PDB: d2h9ga1, d2h9ga2, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl1, d2h9gl2
    automated match to d1d0gr1

Details for d2h9gs1

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
PDB Compounds: (S:) Tumor necrosis factor receptor superfamily member 10B precursor

SCOPe Domain Sequences for d2h9gs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9gs1 g.24.1.1 (S:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOPe Domain Coordinates for d2h9gs1:

Click to download the PDB-style file with coordinates for d2h9gs1.
(The format of our PDB-style files is described here.)

Timeline for d2h9gs1: